PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D12G0947
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 359aa    MW: 40136.4 Da    PI: 8.1592
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D12G0947genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.46.3e-41124201178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +CqvegC++ l +akeyhrrhkvCe+hskap+v+v gleqrfCqqCsrfh +sefD++krsCrrrLa+hnerrrk+++
  Gh_D12G0947 124 RCQVEGCNVTLVNAKEYHRRHKVCETHSKAPKVVVLGLEQRFCQQCSRFHVVSEFDDSKRSCRRRLAGHNERRRKTSH 201
                  6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.2E-35118186IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.607122199IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.12E-38123203IPR004333Transcription factor, SBP-box
PfamPF031102.6E-32125198IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MEHDDMFMGN RSQTGNKYNP NNATTNSFNF ETTLTESHAL NHHHHHHQQR HSLYAGDGSS  60
RIHQSADPHL VCLKLGKRHY FEGSSDLNNH RHSAGGYSIG KKGKPYYDNL SGEGGGPSSS  120
TVPRCQVEGC NVTLVNAKEY HRRHKVCETH SKAPKVVVLG LEQRFCQQCS RFHVVSEFDD  180
SKRSCRRRLA GHNERRRKTS HDSATRNFAQ VCCQTDNKPM TGSFPYVSSP TGRALSLLSS  240
KVDSWISPSN LSTRSSAALR ELIVENRAAV LAQQPVLERD WQYIGEPQPA GSNPIFVQHH  300
SLLDPHGWDV QFPETGGQVT LDLMQASNSA FGMLSVRGKT KEEEEECSEL WHSLQGTHG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-31115198184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.26180.0boll| ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223180.0KJ622318.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL10) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012437523.10.0PREDICTED: squamosa promoter-binding-like protein 7 isoform X1
TrEMBLA0A0D2U0Y40.0A0A0D2U0Y4_G
STRINGPOPTR_0002s14330.11e-119(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15613914
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.41e-39squamosa promoter binding protein-like 10